Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 285554 > 

285554-31-6

Basic Information
CAS No.: 285554-31-6
Name: H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH
Molecular Structure:
Molecular Structure of 285554-31-6 (H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH)
Formula: C223H347N59O65S
Molecular Weight: 4926.61
Synonyms: H-ASP-ALA-GLU-PHE-ARG-HIS-ASP-SER-GLY-TYR-GLU-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-ILE-ALA-THR-VAL-ILE-VAL-OH;DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV;
  • Display:default sort

    New supplier

  • HIGH PURITY-CAS285554-31-6-99%

  • Casno:

    285554-31-6

    HIGH PURITY-CAS285554-31-6-99%

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • Amyloidpeptide1-46

  • Casno:

    285554-31-6

    Amyloidpeptide1-46

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    GMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,

  •  Xiamen Jenny Chemical Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86

    Address:xiameng

       Inquiry Now

  • BETA-AMYLOID (1-46)

  • Casno:

    285554-31-6

    BETA-AMYLOID (1-46)

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemicals. W

    Shandong Mopai Biotechnology Co., LTD is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, s

  •  Shandong Mopai Biotechnology Co., LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-15965530500

    Address:shandong

       Inquiry Now

  • BETA-AMYLOID (1-46)

  • Casno:

    285554-31-6

    BETA-AMYLOID (1-46)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    factory?direct?sale Application:Fine chemical intermediates, used as the main raw material for the synthesis of various pesticides, medicines, surfactants, polymer monomers, and antifungal agents

    Antimex Chemical Limied, was founded in 2001, we are specializing in manufacturing & researching of Active pharmaceutical Ingredients,Veterinary pharm APIs,cosmetic ingredients,and

  •  Antimex Chemical Limied

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0086-21-50563169

    Address:Room1027,No.Jinyu Road,Pudong

       Inquiry Now

  • Amyloid β-Protein 1-46

  • Casno:

    285554-31-6

    Amyloid β-Protein 1-46

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    Shanghai Apeptide Co.,Ltd is one of famous-peptide manufacturers in China. For 10 years we have supplied peptides/API pepitdes/Custom Peptide/ Amino acides/ protein etc... Our website address: www.apeptides.com/en/ We have amyloid peptides

    APeptide is one of the largest custom peptide producers in China (For 10years old), we can be proud to offer reliable, high quality, competitive price peptide services directly

  • Shanghai Apeptide Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-21-60871011

    Address:No. 80 Chuanshan Shuyuan Steet,Pudong,Shanghai

       Inquiry Now

  • [Gly28,Cys30]-Amyloid b-Protein (1-30)

  • Casno:

    285554-31-6

    [Gly28,Cys30]-Amyloid b-Protein (1-30)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    *High density and high throughput: simultaneous determination of tens of thousands of protein peptide biochemical reactions*High specificity: deeply reveal the protein binding mechanism, accurately locate the specific epitope of antibody and protein

  • Chinapeptides Co,. Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-021-50792271

    Address:Building 24A, 300 Chuantu Road, Chuansha, Pudong new area, Shanghai, China, 201202

       Inquiry Now

  • Amyloid β-Protein (1-46)

  • Casno:

    285554-31-6

    Amyloid β-Protein (1-46)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    peptide expert with good price, fast delivery and high qualityAppearance:white powder Storage:keep sealed and keep from direct light Package:According to client's requirements Application:cosmetic or pharmaceutical Transportation:According to client'

    Chengdu YoungShe Chemical Co.,Ltd is a dynamic and progressive cosmetic peptides supplier in China. We are dedicating to be the most professional, efficient,and reliable partner fo

  • Chengdu Youngshe Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-28-62328193

    Address:6,23th FL,Building 1,No 666,Jitai Rd,New and Hi-tech zone,Chengdu,China

       Inquiry Now

  • Total:8 Page 1 of 1 1
Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 285554-31-6