Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 357952 > 

357952-10-4

Basic Information
CAS No.: 357952-10-4
Name: FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
Molecular Structure:
Molecular Structure of 357952-10-4 (FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2)
Formula: C186H312 N52 O52 S2
Molecular Weight: 4172.91468
Synonyms: Mouseurocortin 3; Mouse urocortinIII; Stresscopin (mouse); UrocortinIII (mouse)
  • Display:default sort

    New supplier

  • Manufacturer supply CAS 357952-10-4 with best quality

  • Casno:

    357952-10-4

    Manufacturer supply CAS 357952-10-4 with best quality

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 139.0-210.0

    WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

    Zhuo Zhou Wen Xi Import and Export Co., Ltd. is a company mainly engaged in the export of pharmaceutical raw materials. Its parent company is (Wen Xi Pharma), including three subs

  •  Zhuozhou Wenxi import and Export Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-13111626072

    Address:Room 1710, Baoxin International Phase I, 19 Guanyun East Road, Zhuozhou, Hebei

       Inquiry Now

  • FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

  • Casno:

    357952-10-4

    FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

    Min.Order: 10 Gram

    FOB Price:  USD $ 0.0-0.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • Urocortin III (mouse)

  • Casno:

    357952-10-4

    Urocortin III (mouse)

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    GMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,

  •  Xiamen Jenny Chemical Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86

    Address:xiameng

       Inquiry Now

  • Hot sale Urocortin III CAS 357952-10-4

  • Casno:

    357952-10-4

    Hot sale Urocortin III CAS 357952-10-4

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0

    Our advantages: 1, High quality with competitive price: 1) Standard:BP/USP/EP/Enterprise standard 2) All Purity≥99% 3) We are manufacturer and can provide high quality products with factory price. 2, Fast and safe delivery 1) Parcel can be

    HEALTHTIDE BIOTECH CO.,LTD is a collection of production and sales of biotechnology companies.Our company mainly sells plant extracts, chemical raw materials,food additives,raw mat

  •  healthtide biotech co.,ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+852 65031356

    Address:No. 45 Beijing Road, Qianwan Free Trade Port, Qingdao Area, China Pilot Free Trade Zone

       Inquiry Now

  • 357952-10-4

  • Casno:

    357952-10-4

    357952-10-4

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High quality,stable supply chain.Appearance:white/off-white or light yellow Storage:Store in cool and dry place, keep away from strong light and heat. Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Application:This product can be use

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Suzhou Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • Urocortin III, mouse

  • Casno:

    357952-10-4

    Urocortin III, mouse

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High-quality peptides at competitive prices.Appearance:Powder Storage:Cool dried place Package:PP bags inside,outside aluminium foil bag Application:Intermediate,peptides Transportation:Express, sea, air, land. Port:Shanghai,China

    Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Produ

  •  Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-571-85829053

    Address:Rm A606, Fuyi Center, jianqiao street, Jianggan Area

       Inquiry Now

  • FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

  • Casno:

    357952-10-4

    FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    high quality Storage:Sealed, dry, microtherm , avoid light and smell. Package:According to the demand of customer Application:Organic synthesis Transportation:by air or by sea

    Located in Zhengdong New District,?Zhengzhou of Henan province, Henan Allgreen Chemical Co.,Ltd is a comprehensive high-tech modern enterprises integrating professional R&D, pro

  •  Henan Allgreen Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-0371-87507775

    Address:No 260 Dongming Road,Jinshui District

       Inquiry Now

  • Stresscopin (3-40) (mouse) CAS No.357952-10-4

  • Casno:

    357952-10-4

    Stresscopin (3-40) (mouse) CAS No.357952-10-4

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Appearance:solid or liquid Storage:sealed in cool and dry place Package:As customer's requested Application:Pharma Intermediate Transportation:by courier/air/sea Port:Any port in China

    Guangdong Juda Chemical Industrial Co.,Limited is a company specializing in APIs,pharmaceutical intermediates, electronic chemicals, plant extracts,fine chemicals and cosmetics raw

  •  Guangdong Juda Chemical Industrial Co.,Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 13510152023(whatsapp)

    Address:Guangzhou chemical city Tianhe District Guangzhou Guangdong China

       Inquiry Now

  • Urocortin III, mousewith factory price

  • Casno:

    357952-10-4

    Urocortin III, mousewith factory price

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Wuhan Sun-shine Bio-technology Corporation Limited is specializing in the anticancer, antitumor,heart head blood-vessel,pharmaceutical intermediates,fine Chemicals production and customization. Company has strong ability of research and development

    Wuhan Sun-shine Bio-technology Corporation Limited (Shanghai Sun-shine Chemical Technology Corporation Limited) is a high-tech enterprise engaged inR&D and sales of related compoun

  • Wuhan Sun-shine Bio-technology Corporation Limited

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+862765522452

    Address:武汉市东湖高新区高新二路388号生物医药加速器16栋501

       Inquiry Now

  • UrocortinIII,mouse

  • Casno:

    357952-10-4

    UrocortinIII,mouse

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Watson International Ltd' has a very strong R&D and technical capacity supported by FCAD's platform. The subsidiaries under FCAD Group have accumulated much know-how of different fine chemical branches. For example, Apnoke Scientific L

    Watson International Ltd is the business department of FCAD Group. FCAD helps clients from different fields to develop their required fine chemicals or formulations. From pharmaceu

  • Watson International Ltd

    United Kingdom  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+44 (0)2036089360-31

    Address:Chanceryhouse,Chancery Lan

       Inquiry Now

  • Stresscopin (3-40) (mouse)

  • Casno:

    357952-10-4

    Stresscopin (3-40) (mouse)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    FINETECH INDUSTRY LIMITED is a LONDON based CRO company providing drug discovery & development services to worldwide clients. FINETECH INDUSTRY LIMITED supplies the Stresscopin (3-40) (mouse), CAS:357952-10-4 with the most competitive price and the b

    Finetech Industry Limited is a company in England,which specializing in developing, manufacturing and marketing fine organic compounds and intermediates for the fine chemical and p

  • Finetech Industry Limited

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-87465837

    Address:wuhan

       Inquiry Now

  • 357952-10-4

  • Casno:

    357952-10-4

    357952-10-4

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of Agricultural Sciences, Institute of Ecological Science Park, Beijing

    we a state-level key high-tech enterprises in Yixing Environmental Science and Technology High-tech Development Zone. The company, China Agricultural University, Chinese Academy of

  • wuxi leji biology technology co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:18362718864

    Address:The Nanyue Road No. 2, Yixing City, Jiangsu Province

       Inquiry Now

  • Urocortin III, mouse manufacturer

  • Casno:

    357952-10-4

    Urocortin III, mouse manufacturer

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Known for its best quality and competitve price, this chemicals we offered is widely appreciated by our customers.Appearance:White powder Storage:keep sealed and keep from direct light Package:According customer's requirements Application:cosmetic pe

    Hangzhou Peptidego Biotech. Co.,Ltd is an internationally recognized biochemical manufacturing company which specialized in the production of peptide reagents, custom peptides and

  • Hangzhou Peptidego Biotech Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0571-87213919

    Address:6-204,No.688,Bin'an road,Changhe street,BinJiang district,Hangzhou,Zhejiang,CN

       Inquiry Now

  • FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

  • Casno:

    357952-10-4

    FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    more information,pls contact with us!

    This information applies to the shipment of our products from Peptide Institute, Inc., Japan. Handling and shipping of orders placed with overseas sales agents may vary. LIABILITY

  • PEPTIDE-INST

    Japan  |  Contact Details

    Business Type:Trading Company

    Tel:+81 (0) 72 729 4121

    Address:4-1-2 Ina, MINOH-SHI, OSAKA 562-8686 JAPAN

       Inquiry Now

  • FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

  • Casno:

    357952-10-4

    FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    more information,pls contact with us!

    Peptides International manufactures and distributes a wide variety of high purity, biologically active peptides and peptide-related products that are used in major research institu

  • PEPNET

    United States  |  Contact Details

    Business Type:Trading Company

    Tel:800 777 4779

    Address:P. O. Box 24658 Louisville, Kentucky 40224-0658 USA

       Inquiry Now

  • Total:19 Page 1 of 1 1
Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 357952-10-4