119418-04-1

Basic information

• Product Name: GALANIN, HUMAN
• Synonyms: H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER-OH;GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER;GALANIN, HUMAN;GALANIN (1-30) (HUMAN);M.W. 3157.41 C139H210N42O43;Galanin, people
• CAS NO: 119418-04-1
• Molecular Formula: C139H210N42O43
• Molecular Weight: 3157.41
• Product Categories: Peptide;Galanins;Neuropeptides;Peptides for Cell Biology;Galanin receptor
• Mol File: 119418-04-1.mol
• Article Data: 0

Chemical Properties

• Appearance: /powder
• Storage Temp.: −20°C
• CAS DataBase Reference: GALANIN, HUMAN(CAS DataBase Reference)
• NIST Chemistry Reference: GALANIN, HUMAN(119418-04-1)
• EPA Substance Registry System: GALANIN, HUMAN(119418-04-1)

Safety Data

• WGK Germany: 3
• Hazardous Substances Data: 119418-04-1(Hazardous Substances Data)

Usage

Description

Galanin, also known as GALANIN, HUMAN, is a neuropeptide consisting of 29 amino acids. It exhibits a broad range of expression in both the central and peripheral nervous systems and functions as a ligand for three G-protein coupled receptor (GPCR) subtypes, namely GalR1, GalR2, and GalR3.

Uses

Used in Research Applications:
Galanin, HUMAN is used as a research tool for studying the effects of various substances on the expression of intestinal peptides. It aids in understanding the impact of mycotoxins, such as zearalenone, on the gastrointestinal system.
Used in Neuroscience Research:
Galanin, HUMAN is utilized as a neuroscientific research agent to explore its role in the central and peripheral nervous systems. This helps in investigating its interactions with the G-protein coupled receptors (GPCRs) GalR1, GalR2, and GalR3, and its potential implications in neurological disorders and functions.
Used in Drug Development:
Galanin, HUMAN serves as a target for drug development, focusing on the modulation of its interactions with the GPCRs. This can lead to the creation of therapeutic agents that may have potential applications in treating neurological conditions and disorders related to the central and peripheral nervous systems.

Biochem/physiol Actions

Galanin (GAL) is involved in multiple physiological actions such as, nociception, cognition, memory, hunger, hormone and neurotransmitter release, and cell growth. It also controls the release of gastric acid, plays a role in the contraction of intestines, and suppresses the secretion of pancreatic peptides. This peptide is up-regulated in colorectal cancer (CRC), which relates to aggressive phenotype and poor prognosis of patients with stage II CRC. Studies in Chinese Han female population show that polymorphisms in this gene are linked to susceptibility to depression.